PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676721204
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family HSF
Protein Properties Length: 80aa    MW: 9106.29 Da    PI: 4.8899
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676721204genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind71.41.7e-221568255
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHH CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvR 55
                  Fl+k+y++++d+++++++sw+e+g++fvv+++ efak++Lp+yFkh+nf+SF+R
     676721204 15 FLSKTYQLVDDQSTDDVVSWNEDGTAFVVWKTAEFAKDLLPQYFKHNNFSSFIR 68
                  9****************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.103.7E-24768IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004154.7E-171180IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467852.18E-191269IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000563.7E-131538IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004476.3E-191568IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.7E-135365IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MTAVMVAQRS VPAPFLSKTY QLVDDQSTDD VVSWNEDGTA FVVWKTAEFA KDLLPQYFKH  60
NNFSSFIRFP ENCPGQMGVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1hks_A1e-151068360HEAT-SHOCK TRANSCRIPTION FACTOR
1hkt_A1e-151068360HEAT-SHOCK TRANSCRIPTION FACTOR
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325124e-82AC232512.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB065B14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195416.11e-39heat stress transcription factor B-1
RefseqXP_002866968.11e-39hypothetical protein ARALYDRAFT_490909
RefseqXP_013722981.14e-40PREDICTED: heat stress transcription factor B-1-like
SwissprotQ963201e-41HSFB1_ARATH; Heat stress transcription factor B-1
TrEMBLA8IXQ21e-39A8IXQ2_BRACM; Heat shock factor 4
TrEMBLC0SVM01e-39C0SVM0_ARATH; Putative uncharacterized protein At4g36990 (Fragment)
TrEMBLD7MB011e-39D7MB01_ARALL; Putative uncharacterized protein
TrEMBLJ7FYU67e-42J7FYU6_ARATH; Truncated heat shock factor B1
STRINGAT4G36990.13e-39(Arabidopsis thaliana)
STRINGfgenesh2_kg.7__342__AT4G36988.14e-39(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96528111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36990.18e-43heat shock factor 4